PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1951s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 517aa    MW: 56521.3 Da    PI: 5.3307
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1951s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-174087148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  SapurV1A.1951s0020.1.p 40 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                            79******************************************9986 PP

2Myb_DNA-binding49.59.4e-1693136146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             +g++T+eE+  +v++++++G++ W++ a++++ gRt++++k++w++
  SapurV1A.1951s0020.1.p  93 KGAFTPEEENCIVELHAMMGNK-WARMAAELP-GRTDNEIKNYWNT 136
                             799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7053587IPR017930Myb domain
SuperFamilySSF466899.73E-3037134IPR009057Homeodomain-like
SMARTSM007172.4E-153989IPR001005SANT/Myb domain
PfamPF002492.2E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-234194IPR009057Homeodomain-like
CDDcd001675.57E-124287No hitNo description
PROSITE profilePS5129424.50388142IPR017930Myb domain
SMARTSM007172.2E-1592140IPR001005SANT/Myb domain
PfamPF002498.1E-1593136IPR001005SANT/Myb domain
CDDcd001677.90E-1195136No hitNo description
Gene3DG3DSA:1.10.10.609.0E-2595140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MSSMMDDSEV SKRSKGCHGS PAADEVNDGG MVGGMIPLKK GPWTSAEDAI LIDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPD LKKGAFTPEE ENCIVELHAM MGNKWARMAA  120
ELPGRTDNEI KNYWNTRIKR MQRASLPIYP PDVCLRLYKT IQDGQIMGTL QTGDTYDPEL  180
MQTDHFKIPE VEFKNLELSR GVPSYSLGLF DTSASSMLKQ GVGSFYGNGL VFPTMHPAKR  240
PRESQTIFTG LDGIVGRGLP VFDQLTDYPC GKIIEHSGLS SPYDPDLSTY DQPSWDVLPG  300
SHAILNDNSS SASAPICVAK KLELPSLQYS ESHQDSWGTP ASPLPSLESV DTLIQSPTTK  360
EMWSDGQSSR SSGLLDAVLY ESRNLKNSKK CSGHPTSDVS VAFGEIHGSP LNPSETEWEV  420
HADLKSPSGH STSSLFSECT PVSGSSLDGR AYNVRPEPVD QVLIPYAEAR KAPNQTDCNK  480
PDVLLGTAWF TPSNNCQKDQ FFQTDDVAAD LGGDQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32341401106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313492.10.0hypothetical protein POPTR_0009s02380g
TrEMBLB9HPW80.0B9HPW8_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.33e-90myb domain protein 33